Protein Info for Rru_A0373 in Rhodospirillum rubrum S1H

Annotation: flavodoxin/nitric oxide synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 TIGR01755: NAD(P)H:quinone oxidoreductase, type IV" amino acids 5 to 200 (196 residues), 282.6 bits, see alignment E=1e-88 PF03358: FMN_red" amino acids 6 to 145 (140 residues), 50.1 bits, see alignment E=3.4e-17 PF00258: Flavodoxin_1" amino acids 9 to 123 (115 residues), 34.3 bits, see alignment E=3.8e-12

Best Hits

Swiss-Prot: 100% identical to NQOR_RHORT: NAD(P)H dehydrogenase (quinone) (Rru_A0373) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03809, Trp repressor binding protein (inferred from 100% identity to rru:Rru_A0373)

MetaCyc: 59% identical to NAD(P)H:quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
NAD(P)H dehydrogenase (quinone). [EC: 1.6.5.2]

Predicted SEED Role

"Trp repressor binding protein"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.2

Use Curated BLAST to search for 1.6.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXG7 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Rru_A0373 flavodoxin/nitric oxide synthase (NCBI) (Rhodospirillum rubrum S1H)
MSDTTKVLVLYYSMYGHIDTLAKEIAAGVAEVDGVEVALKRVPEHMSAELLSTIHARTDF
DTPIASVDELADYDGILIGTPTRFGNMAGQMRNFLDQTGGLWAKGKLVGKAGGAFTSTAT
GGGAETTLLSVYTNFLHHGMVVVGVPYGTPEMFDTSEARAGGPYGAATLAGGDGSRQPSD
KERTIARFQGRHFAGVAKKLKG