Protein Info for Rru_A0361 in Rhodospirillum rubrum S1H

Annotation: Methylthioadenosine phosphorylase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF01048: PNP_UDP_1" amino acids 10 to 246 (237 residues), 136.8 bits, see alignment E=4e-44 TIGR01694: methylthioadenosine phosphorylase" amino acids 10 to 246 (237 residues), 296.6 bits, see alignment E=6.1e-93

Best Hits

Swiss-Prot: 100% identical to MTAP_RHORT: S-methyl-5'-thioadenosine phosphorylase (mtnP) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00772, 5'-methylthioadenosine phosphorylase [EC: 2.4.2.28] (inferred from 100% identity to rru:Rru_A0361)

MetaCyc: 100% identical to S-methyl-5'-thioadenosine phosphorylase monomer (Rhodospirillum rubrum)

Predicted SEED Role

"5'-methylthioadenosine phosphorylase (EC 2.4.2.28)" in subsystem Methionine Salvage (EC 2.4.2.28)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXH9 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Rru_A0361 Methylthioadenosine phosphorylase (NCBI) (Rhodospirillum rubrum S1H)
MSEAYRQPVLGVIGGSGVYDIDGLEGARWQTVESPFGDVSDQILRGTLDGLEMAFLPRHG
RGHVLAPSDVNYRANIDALKRAGVTEILSVSAVGSLAEDLPPGTFVIADQFIDRTFAREK
SFFGKGLVAHVSMAHPVSAWLGDRVEEVLADLAIPHRRGGTYLCMEGPQFSTLAESNLYR
QWGCHVIGMTNMPEAKLAREAEIAYCTVAMVTDFDCWHPDHDHVSVEAVVRVLLQNADKA
RSLVKAMPAKLKDRPYPLPDGSHRSLDNAIITHPDRRNPGMARKLSAVAGRVLG