Protein Info for Rru_A0345 in Rhodospirillum rubrum S1H

Annotation: CRISPR-associated protein, CT1976 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 48 (17 residues), see Phobius details TIGR01868: CRISPR-associated protein Cas5/CasD, subtype I-E/ECOLI" amino acids 5 to 239 (235 residues), 293.4 bits, see alignment E=6.7e-92 PF09704: Cas_Cas5d" amino acids 6 to 235 (230 residues), 118.7 bits, see alignment E=1.9e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0345)

Predicted SEED Role

"CRISPR-associated protein, Cas5e family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXJ5 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Rru_A0345 CRISPR-associated protein, CT1976 (NCBI) (Rhodospirillum rubrum S1H)
MPEHRWLIVHLEAPLLAFGGVAIDNVGVTRDFPAASMLTGLFANALGWRRTEWERHQRLQ
DRLIFAARRERENPTGVLTDTQNAKLSKTERGWTTWGEPEGRDGASYGAPHRRRRDYHGD
ASVVVALRLDAAEEPALDDLAAALDRPARPLFIGRKSCVPSRPLRGKEFVVAATAYQALQ
ALRSDGNDRQRDGAAAERRAVWPVGEGPVDGPAVHRIHDLPDLRNWRTGLHGGTRPIVEG
VVVAQGAGL