Protein Info for Rru_A0325 in Rhodospirillum rubrum S1H

Annotation: Molybdenum cofactor biosynthesis protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 7 to 335 (329 residues), 320.4 bits, see alignment E=6.1e-100 PF04055: Radical_SAM" amino acids 21 to 182 (162 residues), 90.3 bits, see alignment E=2.4e-29 PF13353: Fer4_12" amino acids 24 to 125 (102 residues), 24.9 bits, see alignment E=3.4e-09 PF06463: Mob_synth_C" amino acids 189 to 314 (126 residues), 101.9 bits, see alignment E=4e-33

Best Hits

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 100% identity to rru:Rru_A0325)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXL5 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Rru_A0325 Molybdenum cofactor biosynthesis protein (NCBI) (Rhodospirillum rubrum S1H)
MGATGRLVDRFGRAITYLRLSVTDRCNFRCVYCMGEDITFLPMRDLLTIEELDRLCAAFI
GLGVRKLRLTGGEPLVRRGVETLIGHLGEHVAAGRLDELTLTTNGARLAAFAPGLVLAGV
RRVNVSLDTLDGDRFRQLTRLGDLETVLAGIAAAKAQGLAVKINAVVFEGGPEGDIDALI
AWCGAQGHDLTLIEAMPFGGMAGLGDGHRSFLEGLRRRLAERWSFEACDHATGGPARYVR
VAQTGGRLGFIAPISGCFCDGCNRVRVTCTGALHPCLDGGATADLRAALRAGESNGPLER
AIDEGLRAKPRGHGFNTLIEHGRVSLGRHMSVTGG