Protein Info for Rru_A0320 in Rhodospirillum rubrum S1H

Annotation: NADH dehydrogenase (quinone) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 19 to 19 (1 residues), see Phobius details amino acids 33 to 53 (21 residues), see Phobius details amino acids 71 to 95 (25 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 165 to 189 (25 residues), see Phobius details amino acids 212 to 237 (26 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details amino acids 309 to 334 (26 residues), see Phobius details amino acids 346 to 364 (19 residues), see Phobius details amino acids 375 to 393 (19 residues), see Phobius details amino acids 411 to 434 (24 residues), see Phobius details amino acids 495 to 517 (23 residues), see Phobius details PF00662: Proton_antipo_N" amino acids 67 to 99 (33 residues), 32.1 bits, see alignment (E = 8.5e-12) PF00361: Proton_antipo_M" amino acids 130 to 425 (296 residues), 218.1 bits, see alignment E=1.6e-68

Best Hits

KEGG orthology group: K05903, NADH dehydrogenase (quinone) [EC: 1.6.99.5] (inferred from 100% identity to rru:Rru_A0320)

Predicted SEED Role

"Formate hydrogenlyase subunit 3/Multisubunit Na+/H+ antiporter, MnhD subunit" in subsystem Formate hydrogenase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.99.5

Use Curated BLAST to search for 1.6.99.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXM0 at UniProt or InterPro

Protein Sequence (531 amino acids)

>Rru_A0320 NADH dehydrogenase (quinone) (NCBI) (Rhodospirillum rubrum S1H)
MANSSLLLLLFLIPALGAVVEYPLGRARSALAGAPSVAGALGAFAVAVTMAFRIAESGDL
FALGGWFHADALSAVVAIVVTFVGLAATLFSIGYLRHEVEAGQYSQTRLPVYFVLNSVFI
ATMAAVTVTNNVIMMYVVVEATTLASALLVTYYRKPGAWEAGYKYLLLCSVGITMGLLGC
VILYSAAVPLLGGHRAMQISELATVADQLPPTAVVVGCVLIIIGFGSKAGLIPFHAWLPD
AHSQSPSPVSALLSGVTLKVAIYAIARIASLFYAGHGALGVFCIVLGAITMLGGIIAAFS
QTDLKRLLAYSSVSQVGYIIMGLGIGSYLGFYGAVYHLMNHALDKAMLFLCTGLLLYSCG
TTSIEELGKRKHSPLVALCFFIGALAISGVPPLNGFWSKFAIYTAAAEAHLWWALGVALL
TSLITIAVLVRAGYLIFLRNTDHDHGSTDVSGDAALAFGDGAATPTFDGSAGTPAFDGSA
VLAVGGRVPHQGYPVMMIGVVVTMTVLVVVTGLNLSVFNRLIDLSVGVLLR