Protein Info for Rru_A0317 in Rhodospirillum rubrum S1H

Annotation: Respiratory-chain NADH dehydrogenase, subunit 1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 219 to 237 (19 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details PF00146: NADHdh" amino acids 8 to 289 (282 residues), 204.2 bits, see alignment E=1.6e-64

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0317)

Predicted SEED Role

"Formate hydrogenlyase subunit 4" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXM3 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Rru_A0317 Respiratory-chain NADH dehydrogenase, subunit 1 (NCBI) (Rhodospirillum rubrum S1H)
MENVGLAIFNVLLVVCAAPLLDGVLRQVKARIHSRQGPPILQTYFDLAKLLVKEDQRGVN
QLLFAWAPVVCMASVILSALFVPMAGLSPLGFSGDAIVFLYVLTMAPLCMCLGGMASGSP
YAYAGANREIMTLMAVEPVVAICLITSGIRAHSLNLADCVNAYAAGAPALSMIIATIAFF
LILPAELSKVPFDQAEAETEIMEGPLIEYSGRKLALFKWSFYAKQIVLITLFVEWFLPWP
HMNFVPLDILATLIKVVIVAVIIEVIAQIFPRFKIHQSIRYFYAVVAFSVGGLVLAVMGL