Protein Info for Rru_A0314 in Rhodospirillum rubrum S1H

Annotation: NADH dehydrogenase (quinone) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 46 to 71 (26 residues), see Phobius details amino acids 91 to 117 (27 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 322 to 344 (23 residues), see Phobius details amino acids 356 to 376 (21 residues), see Phobius details amino acids 394 to 412 (19 residues), see Phobius details amino acids 432 to 455 (24 residues), see Phobius details amino acids 475 to 499 (25 residues), see Phobius details PF00662: Proton_antipo_N" amino acids 89 to 139 (51 residues), 41.1 bits, see alignment 1.3e-14 PF00361: Proton_antipo_M" amino acids 155 to 439 (285 residues), 190.5 bits, see alignment E=3.9e-60

Best Hits

Swiss-Prot: 43% identical to HYFD_ECOLI: Hydrogenase-4 component D (hyfD) from Escherichia coli (strain K12)

KEGG orthology group: K12139, hydrogenase-4 component D [EC: 1.-.-.-] (inferred from 100% identity to rru:Rru_A0314)

Predicted SEED Role

"Hydrogenase-4 component D"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXM6 at UniProt or InterPro

Protein Sequence (505 amino acids)

>Rru_A0314 NADH dehydrogenase (quinone) (NCBI) (Rhodospirillum rubrum S1H)
MLDDVVTRVLPAGGAAVPGSGHGPGAVPRWNGAGHRPASPRAGANGVIFLASLIFSGLAL
AGAIAAILAVFPGPWTLGLGRLPWLASDQALFGLALDPLSCLMLVVITLCGFLVVLYSGG
YMSLGNVEHPSDANLARYYFFVCLFITAMVGLVSSPNYFQLFLFWELTTLCSWGLISFYG
DAEALKSAYKALLITHGAGLFLAAAVVLIYVETGSFAFDAINLLTPGLKSLVIAFMGIAA
LAKAAQFPFFTWLPTAMAAPTPASSYLHAAAMVKAGIYLLARLALSVDAFPPELGLALSV
IAIVTMCLAVVLYFPQDDLKRLLAFSTIANLGYMVLGIAMGAMGSRTALEGGMLHLVGHS
FTKSLLFLAVGAISYATGTRKIGLLSGLGRKMPVTALAFVLGAMAISGMPPFNMFWSKYL
IVSGAIELSSTWGWTLAVLTLAESVAGFAWFLHIVHKVFFGPVSPTAENARDPGAAMLIP
LIVLMAFSVLSTVFALPMIQQSFGG