Protein Info for Rru_A0309 in Rhodospirillum rubrum S1H

Annotation: 4Fe-4S ferredoxin, iron-sulfur binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF13247: Fer4_11" amino acids 77 to 128 (52 residues), 37 bits, see alignment E=1.5e-12 PF12838: Fer4_7" amino acids 82 to 127 (46 residues), 27.7 bits, see alignment 1.4e-09 PF12797: Fer4_2" amino acids 105 to 125 (21 residues), 29.9 bits, see alignment (E = 1.5e-10) PF12837: Fer4_6" amino acids 106 to 127 (22 residues), 31.4 bits, see alignment (E = 5.8e-11) PF00037: Fer4" amino acids 107 to 127 (21 residues), 30.2 bits, see alignment (E = 1.3e-10)

Best Hits

KEGG orthology group: K05796, electron transport protein HydN (inferred from 100% identity to rru:Rru_A0309)

Predicted SEED Role

"4Fe-4S ferredoxin, iron-sulfur binding"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXN1 at UniProt or InterPro

Protein Sequence (212 amino acids)

>Rru_A0309 4Fe-4S ferredoxin, iron-sulfur binding (NCBI) (Rhodospirillum rubrum S1H)
MVRPSSAVAGGCCLEVRLLKPDSLNYFILADSDKCIGCRMCEIACAVTHSEDKPETVGAL
DGPLVPRLFVVVTDDVTVPVICRHCEDAPCASVCKMAAISRVDGKVLVDAERCVGCRLCL
MACPFGATEFVPQPADAAPVYITPADGRPSRAVKVRYKANKCDLCSGLADGPACVNACPQ
NVLSIVDPAAEVARRALGAVEDLVSSMKFSGL