Protein Info for Rru_A0295 in Rhodospirillum rubrum S1H

Annotation: 3-phosphoshikimate 1-carboxyvinyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 PF00275: EPSP_synthase" amino acids 15 to 439 (425 residues), 336.5 bits, see alignment E=1.1e-104 TIGR01356: 3-phosphoshikimate 1-carboxyvinyltransferase" amino acids 20 to 446 (427 residues), 392 bits, see alignment E=1.6e-121

Best Hits

Swiss-Prot: 100% identical to AROA_RHORT: 3-phosphoshikimate 1-carboxyvinyltransferase (aroA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00800, 3-phosphoshikimate 1-carboxyvinyltransferase [EC: 2.5.1.19] (inferred from 100% identity to rru:Rru_A0295)

Predicted SEED Role

"5-Enolpyruvylshikimate-3-phosphate synthase (EC 2.5.1.19)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXP5 at UniProt or InterPro

Protein Sequence (451 amino acids)

>Rru_A0295 3-phosphoshikimate 1-carboxyvinyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MVPPIPPRPLRAHRSTPLSGRIRVPGDKSISHRALMLGGLAVGRTEIRGLLEGEDVIATA
HAMEAMGARIDRQETADGAGVWTVDGVGVGGLAEPADVLDMGNAGTGARLLMGLLATHDL
TAILTGDASLRGRPMKRVTDPLALFGASFVGRSGGRLPMAVRGTATPLPVSYRVPVPSAQ
VKSAVLLAGLNTPGETTVIEPVATRDHTERMLGHFGAALRLGRDDQGATTITLTGQPELR
AAPVEVPADPSSAAFPLVAAVLVPESHVTLAGVGMNPQRIGLIDTLREMGADILIRDPRI
EAGEPVADLEVRASALTGIEVPAARAPSMIDEYPILAVAAACARGTTRMHGLGELRVKES
DRLSAVATGLAACGVDVTVDGDTLIVHGKGTVPKGGATVAVNLDHRIGMAFLVLGLVSAE
AVTIDDGRAIDTSFPGFVTLMTGLGAPISLI