Protein Info for Rru_A0282 in Rhodospirillum rubrum S1H

Annotation: Protein of unknown function DUF204 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 70 to 90 (21 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 171 to 188 (18 residues), see Phobius details PF02659: Mntp" amino acids 33 to 187 (155 residues), 159.8 bits, see alignment E=2.2e-51

Best Hits

Swiss-Prot: 100% identical to MNTP_RHORT: Putative manganese efflux pump MntP (mntP) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0282)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXQ8 at UniProt or InterPro

Protein Sequence (193 amino acids)

>Rru_A0282 Protein of unknown function DUF204 (NCBI) (Rhodospirillum rubrum S1H)
MSLATLTVLGFSLSADAFAAALGKGAGARRPDLLEAFRVGAYFGAFEAAAPLIGWALGLT
FAARIAAFDHWVAFTLLAGVGGHMVIAALRAPKAETAEASKARQKRALSPLRLALAALAT
SIDATAVGIGLAVTEVNILMACALIGAITTVVAAGGVLLGRGAGPLLGRKAEVLGGLALI
GIGLKILIEHLSA