Protein Info for Rru_A0252 in Rhodospirillum rubrum S1H

Annotation: Zinc-containing alcohol dehydrogenase superfamily (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 172 to 192 (21 residues), see Phobius details PF08240: ADH_N" amino acids 28 to 142 (115 residues), 77.3 bits, see alignment E=1.5e-25 PF00107: ADH_zinc_N" amino acids 181 to 306 (126 residues), 80.8 bits, see alignment E=1.4e-26 PF13602: ADH_zinc_N_2" amino acids 225 to 335 (111 residues), 31.5 bits, see alignment E=4.6e-11

Best Hits

Swiss-Prot: 60% identical to XYLD_AGRFC: Putative D-xylulose reductase (Atu4318) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K05351, D-xylulose reductase [EC: 1.1.1.9] (inferred from 100% identity to rru:Rru_A0252)

Predicted SEED Role

"Xylitol dehydrogenase (EC 1.1.1.9)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXT8 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Rru_A0252 Zinc-containing alcohol dehydrogenase superfamily (NCBI) (Rhodospirillum rubrum S1H)
MKVTGVVLERQGALSLRDIDIPGTLAPGANEVRIAIKSVGICGSDVHYFKHGRIGDFIVT
EPMILGHEASGVVEEIGSAVTHLRVGDRVCMEPGVPDFSSIETLRGMYNLDPSVRFWATP
PYHGCLTAEVVHPASLTYRLPDSVSFAEGAMVEPLAIGVYAAAKAQIRPGDIAVVTGAGT
IGMMVVFAALAAGCAEVIVSDVAAEKLALLASHPEVTTVDLTRESLADAVAARTDGRGVD
VFFEASGSTRPYETMIDLIGRGGRIVLVGMPQEKPQLDVVALQVKEISLTGTFRYANVWD
RTLKLLGSGKIDLKPLISATFPFSDSVRAFDRAAQHLPSDVKIQISL