Protein Info for Rru_A0249 in Rhodospirillum rubrum S1H

Annotation: ABC transporter component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 PF00005: ABC_tran" amino acids 25 to 171 (147 residues), 98.1 bits, see alignment E=6.7e-32 amino acids 271 to 424 (154 residues), 81.2 bits, see alignment E=1.2e-26

Best Hits

Swiss-Prot: 46% identical to RGMG_PSEF5: Putative ribose/galactose/methyl galactoside import ATP-binding protein (PFL_2594) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to rru:Rru_A0249)

Predicted SEED Role

"D-xylose transport ATP-binding protein XylG" in subsystem Xylose utilization

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXU1 at UniProt or InterPro

Protein Sequence (493 amino acids)

>Rru_A0249 ABC transporter component (NCBI) (Rhodospirillum rubrum S1H)
MSSPLLTMRGIRKSYAGVHALVDGNLDLERGQIHALCGGNGAGKSTILGILMGFTRPDCG
EIRIEGKPVSFANPTQALQAGIAIVQQELSGVPHLTVAENIYLGAEPRRRGFVDFPQLNR
QAEELLASLGFDIDPRVPLASLSIASQQLIEIAKALSRRDADILIFDEPTSAIGEKDTLR
LFEVLRDLAAAGKGIIYVTHRLAEVFTIADSYTVFKDGARIETGRVADITREKLIESMIG
GAIEGEYVKENVPSDRPLLDVRGLSRAPWFDRVSFTLHAGEILGIYGLVGSGRSQLLDTI
YGLYPADAGTVWVEGREIRPGRVRAALGAGISYVTEDRKHSGLVLCASVGDNLSLSQLPH
IQRFGFIRTALERAGIDDSIAKMRIKTPGPEQIVRNLSGGNQQKVVFGRCTSIGPKVLLL
DEPTRGVDVGAKKEIYRFVSDFTKAGGAVLMVSSELDEITGMSDRIIVIKKGAHVAEFPR
EETTQKALMMAAV