Protein Info for Rru_A0248 in Rhodospirillum rubrum S1H

Annotation: inner-membrane translocator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 36 to 38 (3 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 272 to 301 (30 residues), see Phobius details amino acids 312 to 330 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 55 to 327 (273 residues), 155.2 bits, see alignment E=9.9e-50

Best Hits

Swiss-Prot: 51% identical to RBSC_HAEIN: Ribose import permease protein RbsC (rbsC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to rru:Rru_A0248)

Predicted SEED Role

"Xylose ABC transporter, permease protein XylH" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXU2 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Rru_A0248 inner-membrane translocator (NCBI) (Rhodospirillum rubrum S1H)
MHITQPAAKAPISLRKYGIVFAFLGLCVLVSALCQLKVVQGAWPENTFLTVNNLMLILHQ
ISVNGVLAVGMTFVVISAGIDLSVGSVLAFSGMMAASMATRSVGVTPWSDTYPVIFPIIA
ALGVGALCGGLSGWIIARFRIQAFIATLGMLLAARGFTMSVTGGNPISGLSPDFRWFGTG
KLFEVIPVPVVILALVFLLAWVILNKTVFGRYVYAVGGNEKSARTSGINTGAILIWVYVV
AGFLAGVAGVILTAKTGSAQTSAGSSYELDAIAAVVIGGASLAGGVGRLTGTFFGALIIG
VMNNGLDILGVQSFYQLIIKGGLIVVAVILDPSRKQAG