Protein Info for Rru_A0244 in Rhodospirillum rubrum S1H

Annotation: IMP dehydrogenase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00478: IMPDH
  • amino acids 6 to 472 (467 residues), 537.6 bits, E=3.1e-165
• TIGR01302: inosine-5'-monophosphate dehydrogenase
  • amino acids 6 to 453 (448 residues), 634.7 bits, E=4.4e-195
• PF00571: CBS
  • amino acids 91 to 140 (50 residues), 49.6 bits, 9.9e-17
  • amino acids 148 to 201 (54 residues), 30.2 bits, 1.1e-10
• PF03060: NMO
  • amino acids 210 to 447 (238 residues), 36.3 bits, E=1.1e-12
• PF01070: FMN_dh
  • amino acids 261 to 361 (101 residues), 26.6 bits, E=7.8e-10

Best Hits

Swiss-Prot: 62% identical to IMDH_ACICA: Inosine-5'-monophosphate dehydrogenase (guaB) from Acinetobacter calcoaceticus

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 100% identity to rru:Rru_A0244)

MetaCyc: 58% identical to inosine 5'-monophosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205) / CBS domain" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• purine nucleotides degradation II (aerobic) (9/11 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• ureide biosynthesis (3/7 steps found)
• adenosine nucleotides degradation I (3/8 steps found)
• purine nucleotides degradation I (plants) (5/12 steps found)
• superpathway of purines degradation in plants (5/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

See Q2RXU6 at UniProt or InterPro

Protein Sequence (487 amino acids)

>Rru_A0244 IMP dehydrogenase (NCBI) (Rhodospirillum rubrum S1H)
MEFPEALTFDDVLLVPAASSVLPAQADTRTRLTRTITLGIPLISSAMDTVTESQMAILMA
QSGGIGVIHKNMTIAAQAEEVRKVKRFESGMVVNPVTINPDASLSTALDLMAHHKISGIP
VTENGSGKLVGILTNRDVRFAENTAKPVSDFMTRDNLITVGEGVSQGEARRLLHTNRIEK
LIVVDESYRCIGLITVKDMEKAQTYPNACKDEKGRLRVAAATGVGADGLARAEALLDAGV
DVVVVDTAHGHSRGVLDAVTAVKKISNYTQVIAGNVATPDGAKALIDAGADAVKIGIGPG
SICTTRIVAGVGVPQFSAITEVAEAVRHTGVPIIADGGIKYSGDLAKAIAGGAETVMVGS
LLAGTSEAPGEVFLYQGRSYKAYRGMGSLGAMARGSADRYFQEEVTNSLKLVPEGIEGQV
PYKGAAGTVIHQLIGGLKAAMGYTGNQTIPEMQKNARFRRITASGWRESHVHDVTITKEA
PNYRGGM