Protein Info for Rru_A0243 in Rhodospirillum rubrum S1H

Annotation: tRNA/rRNA cytosine-C5-methylase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 PF22458: RsmF-B_ferredox" amino acids 137 to 208 (72 residues), 37.6 bits, see alignment E=9.3e-13 PF01135: PCMT" amino acids 228 to 317 (90 residues), 22.3 bits, see alignment E=4.5e-08 PF01209: Ubie_methyltran" amino acids 232 to 315 (84 residues), 31.2 bits, see alignment E=6.6e-11 PF01728: FtsJ" amino acids 236 to 324 (89 residues), 28.2 bits, see alignment E=8e-10 PF13847: Methyltransf_31" amino acids 237 to 375 (139 residues), 47.4 bits, see alignment E=7.7e-16 PF01189: Methyltr_RsmB-F" amino acids 237 to 433 (197 residues), 165.1 bits, see alignment E=7.4e-52 PF13649: Methyltransf_25" amino acids 241 to 315 (75 residues), 34.1 bits, see alignment E=1.7e-11

Best Hits

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 100% identity to rru:Rru_A0243)

Predicted SEED Role

"Sun protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXU7 at UniProt or InterPro

Protein Sequence (454 amino acids)

>Rru_A0243 tRNA/rRNA cytosine-C5-methylase (NCBI) (Rhodospirillum rubrum S1H)
MTPAARVQCAIDLLVDIDATNRPADGIASAFVRARRFMGSKDRRAVTALAWSTLRHRARL
SWLIDRFGGTPKARALVIAHLLVVERQSAEDVRMLFITRAQHAPQPLTDAEERLVDGLAG
KPLEFREMPADVRLEVPDWLPPLLEPLFGERLEDELRALQAEAPLDLRVNALKSDRESAR
LALAREQVDTRPGALSPCALRAEGRPNVAITAPFCDGLVEVQDEGSQMVALLCAVAPGMS
VLDLCAGAGGKTLALAAGMENKGTLVATDISEGRLARAQTRLQRAGVHNVTRKVLDPETR
KWLKRRKASFDVVLVDAPCSGTGTWRRNPDARWKLTPDTISALNAEQSALLDRAAALVKP
GGRLVYATCSLLPAENEAQIAAFLERRDDYRALPVAETWAKVSPAPYPGAADVSWLRLTP
ASHGTDGFFVSILERQPRETADQPDETAPIPEDA