Protein Info for Rru_A0236 in Rhodospirillum rubrum S1H

Annotation: Camphor resistance CrcB protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 98 to 125 (28 residues), see Phobius details TIGR00494: protein CrcB" amino acids 4 to 120 (117 residues), 103.9 bits, see alignment E=3.4e-34 PF02537: CRCB" amino acids 4 to 118 (115 residues), 101.4 bits, see alignment E=1.6e-33

Best Hits

Swiss-Prot: 100% identical to CRCB_RHORT: Putative fluoride ion transporter CrcB (crcB) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K06199, CrcB protein (inferred from 100% identity to rru:Rru_A0236)

Predicted SEED Role

"Protein crcB homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXV4 at UniProt or InterPro

Protein Sequence (129 amino acids)

>Rru_A0236 Camphor resistance CrcB protein (NCBI) (Rhodospirillum rubrum S1H)
MTYLFVAAGGALGSTLRYWLSGLIAGAIGQSFPWGTLVINISGSIVIGAFATLTGPDGRV
FIPGDWRQFFMVGVCGGYTTFSSFSLQTLTLAQEGQGLWAAANVVLSVVFCLIGVWLGHV
GAVLINEGV