Protein Info for Rru_A0235 in Rhodospirillum rubrum S1H

Annotation: preprotein translocase subunit SecA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 896 PF07517: SecA_DEAD" amino acids 8 to 388 (381 residues), 433.6 bits, see alignment E=8.5e-134 TIGR00963: preprotein translocase, SecA subunit" amino acids 28 to 810 (783 residues), 1097.3 bits, see alignment E=0 PF01043: SecA_PP_bind" amino acids 232 to 345 (114 residues), 127.1 bits, see alignment E=1.2e-40 PF21090: P-loop_SecA" amino acids 404 to 609 (206 residues), 306.7 bits, see alignment E=1.8e-95 PF07516: SecA_SW" amino acids 611 to 823 (213 residues), 234 bits, see alignment E=4.4e-73 PF02810: SEC-C" amino acids 876 to 893 (18 residues), 41 bits, see alignment (E = 3.4e-14)

Best Hits

Swiss-Prot: 66% identical to SECA_ACICJ: Protein translocase subunit SecA (secA) from Acidiphilium cryptum (strain JF-5)

KEGG orthology group: K03070, preprotein translocase subunit SecA (inferred from 69% identity to azl:AZL_025630)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXV5 at UniProt or InterPro

Protein Sequence (896 amino acids)

>Rru_A0235 preprotein translocase subunit SecA (RefSeq) (Rhodospirillum rubrum S1H)
MFGAIARRLFGSANDRIVKSLVKTVAAINAKESEVQGLSDADLAARTPWLKSRLAEGETL
DDILVDAFATVREAAKRTLGQRHYDVQLMGGLVLHGGKIAEMRTGEGKTLVATLPVYLNA
LTGKGVHVVTVNDYLAKRDAEWMAKVYRFLGLTVGVIIHELDDGGRRAAYACDVTYGTNN
ELGFDFLRDNMKYRLEDMVQRPFAYAIVDEVDSILIDEARTPLIISGQAEDSSALYQAVD
KLMPRLVPADYEKDEKARSVTYTEEGSDHIEELLREAGLLAEGNLYETRNVTALHHATQG
LRAHTLFERDVHYMVRDDKVVIIDEFTGRAMEGRRFSDGLHQALEAKEGVSIQPENQTLA
SITFQNYFRMYPKLSGMTGTALTEANEFMEIYGLAVVEIPTNRPMIRKDKDDEVYRTSRE
KYEAIAKQIAECQKRGQPVLVGTTSIEKSEYLAELMRTTTKVKPQVLNARYHEQEAFIIA
QAGVPGAVTIATNMAGRGTDIQLGGNLDMRMARELPADATPEQRAAKEAELRADIEKKKA
QALAAGGLYVIGTERHESRRIDNQLRGRTGRQGDPGGSSFYLSLDDDLMRIFGSERMDSM
LRKLGLEEGEAIVHPWVNKALEKAQQKVEARNFDTRKNLLKFDDVMNDQRKVVYEQRRDL
MVTTDVSETVADMRQEVIEDIVHAHIPPKAMPEEWDSAGLAEDVRRVFGLDLPIIDWASE
DGIANEEILERLTKDVEAKMAAKEAEYGADVMRMVEKSLLLQILDGMWKEHLLHLEHLRQ
GISLRAFGQRDPLNEYKSESFEMFQTMLSDLRERVTMTLANVQLRMDPPPPPPEPQGFAE
HVEPEPAIGGGGVPGVAPAATDREAGHPETWGKVARNELCPCGSGKKYKHCHGAMG