Protein Info for Rru_A0226 in Rhodospirillum rubrum S1H

Annotation: Major facilitator superfamily MFS_1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 signal peptide" amino acids 9 to 11 (3 residues), see Phobius details transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details amino acids 302 to 324 (23 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 364 to 385 (22 residues), see Phobius details PF07690: MFS_1" amino acids 14 to 291 (278 residues), 76.9 bits, see alignment E=7.4e-26 amino acids 292 to 397 (106 residues), 34.3 bits, see alignment E=6.4e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0226)

Predicted SEED Role

"transmembrane transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXW4 at UniProt or InterPro

Protein Sequence (446 amino acids)

>Rru_A0226 Major facilitator superfamily MFS_1 (NCBI) (Rhodospirillum rubrum S1H)
MFGVLASVSPLVGGVGVLLLGGALLNTLLGVRLADMGVGATVSALVMAAYYAGLIGGALG
SAKLLGRIGHIRSFAALAALFSAATLAHAFLVDPWSWAVLRLIEGFSMAGLITCTESWLN
MRATERTRGTIFSVYMIATYFSQGIAQFLLTFGDSAAGETGGFRLYALVAILTTLSLVPI
AVTRMPAPEQIDTTSLSLRKLYKISPTGVFGCLTSGMTLGSFYSLGPLFAREIGFDLAQV
ATFMSAVIIGGLILQWPLGRLSDRFDRRLIIIGACLAVAVTCLALGFGQLSGLPLASGSI
HQAFLGVSVLFGALVATLYPVSVAIANDRLAPAEMVAASGGLLFSYSLGAMIGPLIASSV
MEGVGPGGLFLCSAAIATLMALYTLRRIRLRDPAPEDERVPFQIVTNPLPMASAGVDVRS
DIDDRQMSFAFSDSATTAAPPHSEAA