Protein Info for Rru_A0222 in Rhodospirillum rubrum S1H

Annotation: Glyceraldehyde-3-phosphate dehydrogenase, type I (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF00044: Gp_dh_N" amino acids 3 to 104 (102 residues), 129.6 bits, see alignment E=4.8e-42 TIGR01534: glyceraldehyde-3-phosphate dehydrogenase, type I" amino acids 4 to 326 (323 residues), 434.1 bits, see alignment E=1.8e-134 PF02800: Gp_dh_C" amino acids 158 to 314 (157 residues), 212.5 bits, see alignment E=2.5e-67

Best Hits

Swiss-Prot: 72% identical to G3P_XANFL: Glyceraldehyde-3-phosphate dehydrogenase (gap) from Xanthobacter flavus

KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 100% identity to rru:Rru_A0222)

MetaCyc: 56% identical to Gap (Thermotoga maritima)
Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). [EC: 1.2.1.12]

Predicted SEED Role

"NADPH-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.13) / NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Pyridoxin (Vitamin B6) Biosynthesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.12, EC 1.2.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.12 or 1.2.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXW8 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Rru_A0222 Glyceraldehyde-3-phosphate dehydrogenase, type I (NCBI) (Rhodospirillum rubrum S1H)
MAVRVAINGFGRIGRLVLRALVESGRKDVEVVAINDLGSPEANAHLIKFDSVHGVLPGDV
SVSGDVMTIAGTPVKVLAERDPTKLPWGDLNIDIVMECTGIFSDREKAKVHLEAGAKRVL
VSAPSNGADLTVVYGVNHDKLTKDHLVVSNASCTTNCLAPVAQVLHSVFGIEHGFMTTIH
SYTGDQRTVDTLHKDLHRARAAAVSMIPTTTGAAKAVGLVLPELAGKLDGTSIRVPTPNV
SVVDLKVVLSKTATAEAIGAAMKEAAAGKLKGVLGINELPLVSIDFNHNKNSSTFDLPQT
KVVQGTFARVLSWYDNEWGFSNRMLDTAVEMGKLI