Protein Info for Rru_A0218 in Rhodospirillum rubrum S1H

Annotation: Acetyl-CoA carboxylase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00513: acetyl-CoA carboxylase, carboxyl transferase, alpha subunit
  • amino acids 5 to 318 (314 residues), 413.1 bits, E=4.5e-128
• PF03255: ACCA
  • amino acids 7 to 150 (144 residues), 204.5 bits, E=6.9e-65
• PF01039: Carboxyl_trans
  • amino acids 99 to 248 (150 residues), 68.6 bits, E=4.5e-23

Best Hits

Swiss-Prot: 69% identical to ACCA_MAGSA: Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K01962, acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC: 6.4.1.2] (inferred from 100% identity to rru:Rru_A0218)

MetaCyc: 57% identical to acetyl-CoA carboxyltransferase subunit alpha (Escherichia coli K-12 substr. MG1655)
RXN0-5055 [EC: 2.1.3.15]

Predicted SEED Role

"Acetyl-coenzyme A carboxyl transferase alpha chain (EC 6.4.1.2)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.4.1.2)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (14/17 steps found)
• superpathway of fatty acid biosynthesis initiation (5/5 steps found)
• methylaspartate cycle (15/19 steps found)
• biotin-carboxyl carrier protein assembly (4/4 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• propanoyl CoA degradation I (3/3 steps found)
• 3-hydroxypropanoate cycle (10/13 steps found)
• 2-oxobutanoate degradation I (3/4 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• superpathway of the 3-hydroxypropanoate cycle (12/18 steps found)
• fatty acid biosynthesis initiation (type I) (1/3 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• glyoxylate assimilation (7/13 steps found)
• superpathway of L-methionine salvage and degradation (9/16 steps found)
• candicidin biosynthesis (1/6 steps found)
• jadomycin biosynthesis (3/9 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• superpathway of mycolate biosynthesis (27/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis
• Propanoate metabolism
• Pyruvate metabolism
• Tetracycline biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 2.1.3.15 or 6.4.1.2

Sequence Analysis Tools

See Q2RXX2 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Rru_A0218 Acetyl-CoA carboxylase (NCBI) (Rhodospirillum rubrum S1H)
MWTAMHFLDFEKPIAELEGKIEELRHLSDADGINIAEEVGRLQQKVDKQLRAVYAKLTPW
QKALVARHPDRPHCLDYVKALFTDFTPLAGDRLYGEDHAVIGGLARFRGHPVVVIGQEKG
SDTETRLRHNFGMARPEGYRKAQRLMTLAERFHLPVLTLIDTAGAYPGVGAEERGQAEAI
ARTIERGLDLRVPLISCVIGEGGSGGAIAIATGNVVLMLEHAIYSVISPEGCASILWRSG
EMTQQAAEALRLTAQDLLEFKVIDEAIPEPLGGAHRDRAMTFERVGEAFNRHLEQLMPQD
GGVLRARRRDKFLQMGRLELA