Protein Info for Rru_A0217 in Rhodospirillum rubrum S1H

Annotation: Citrate lyase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 57% identical to MCAL_RHOS5: L-malyl-CoA/beta-methylmalyl-CoA lyase (mcl1) from Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)

KEGG orthology group: K08691, malyl-CoA lyase [EC: 4.1.3.24] (inferred from 100% identity to rru:Rru_A0217)

MetaCyc: 66% identical to malyl coenzyme A lyase subunit (Methylorubrum extorquens AM1)
Malyl-CoA lyase. [EC: 4.1.3.24]

Predicted SEED Role

"Malyl-CoA lyase (EC 4.1.3.24)" in subsystem Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle (EC 4.1.3.24)

MetaCyc Pathways

methylaspartate cycle (15/19 steps found)
3-hydroxypropanoate cycle (10/13 steps found)
ethylmalonyl-CoA pathway (8/11 steps found)
superpathway of the 3-hydroxypropanoate cycle (12/18 steps found)
glyoxylate assimilation (7/13 steps found)
formaldehyde assimilation I (serine pathway) (6/13 steps found)
crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (6/14 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXX3 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Rru_A0217 Citrate lyase (NCBI) (Rhodospirillum rubrum S1H)
MSFTLVDQAPARLNRSEQAVPGSNTKFLEKAAKGDADVVFLDLEDAVAPSEKEQARKNII
AALNDLDWSGKTVSLRINGLDTHYMYRDVIDVLEQAPGKLDLIMIPKAGTAADVYALDML
VTQIETATKVDKRIGFELIIETALGMRNIHEIAGASPRNESLHFGVADYAASTKARTTAI
GGPNADYGVLTDPLDDGQRAYHWGDMWHYAIARMVVAARAHGLRPVDGPFGDIGDHDGYR
AQALRAAVLGCEGKWAIHPSQVTLANEVFSPSDKEVAHAQAILDAMEQAGKEGKGAVTLN
GRLIDIASIKQAQVMVDKARQVRAG