Protein Info for Rru_A0189 in Rhodospirillum rubrum S1H

Annotation: ABC transporter, transmembrane region (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 593 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 229 to 258 (30 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 30 to 285 (256 residues), 67.2 bits, see alignment E=2e-22 PF00005: ABC_tran" amino acids 345 to 494 (150 residues), 99.7 bits, see alignment E=2.2e-32

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to rru:Rru_A0189)

Predicted SEED Role

"Transport ATP-binding protein CydC" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RY01 at UniProt or InterPro

Protein Sequence (593 amino acids)

>Rru_A0189 ABC transporter, transmembrane region (NCBI) (Rhodospirillum rubrum S1H)
MAILFDLIRQRAALLSLAMLASAGAAVLGLAPLLAIYTLALEIMGDAPDRQAIHAVVFWT
ALAMGGRWLLLFLSNNWSHMAAYALLFDLRLRIADRLTQLPLGFILTWSSGDLKRVLQED
VERLEMVLGHTLTDVVAAVTLLIGAGIVLVWMDPIMAAAAFAPLPVAIGLQAMLWRGSHD
TVEAYTQAAGRMNAAIVEFIRAIPVIKTFGRGQTSMGHLKRTIDDYQGIVVAFSSAMVPA
WVGFMVALGSGLLFVLPIGGWRLLSGAIDGPTFILFLLLGVGLMQSLVQIITFGNHMRTT
LASIERVRGILDAPTLAGGAITTPPASLDVSFSHVSFSYGEKKVLDDITLTCPPGARTAI
VGPSGAGKTTLAHLAARFWDPQQGAISIGGVPLSDYAPETLVRLTASVFQDVFLFHDTIL
ANLRVGAPDATREQVIAAAREAQIHDFIMTLPDGYDTVLGDRGARLSGGEKQRLSIARAI
LKDAPIVILDEATAFADPVNERRIRTALERLCRDKTVITIAHRLSTIQDADQIAVLDDGR
LVDVGRHDILLTHCAVYQRLWSAYTSPWDGGNGSAAHPPHSQPGFAARQGEVR