Protein Info for Rru_A0178 in Rhodospirillum rubrum S1H

Annotation: CRISPR-associated protein Cas2, putative (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 PF09827: CRISPR_Cas2" amino acids 12 to 76 (65 residues), 68 bits, see alignment E=3.3e-23 TIGR01573: CRISPR-associated endonuclease Cas2" amino acids 12 to 75 (64 residues), 33.8 bits, see alignment E=1.6e-12

Best Hits

Swiss-Prot: 100% identical to CAS2A_RHORT: CRISPR-associated endoribonuclease Cas2 1 (cas2-1) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0178)

Predicted SEED Role

"CRISPR-associated protein Cas2" in subsystem CRISPRs

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RY12 at UniProt or InterPro

Protein Sequence (102 amino acids)

>Rru_A0178 CRISPR-associated protein Cas2, putative (NCBI) (Rhodospirillum rubrum S1H)
MGTRRSNAEHAYVVAYDIADPKRWRQVFKTMKGYGQWVQLSVFQCRLDGGRRIAMASILE
SLIDRETDHVLMLDLGPAEDVDLAVESLGKAFETLERQAMII