Protein Info for Rru_A0164 in Rhodospirillum rubrum S1H

Annotation: Sulfate transporter/antisigma-factor antagonist (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 transmembrane" amino acids 46 to 67 (22 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 103 to 103 (1 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 185 to 212 (28 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 267 to 292 (26 residues), see Phobius details amino acids 312 to 330 (19 residues), see Phobius details amino acids 349 to 381 (33 residues), see Phobius details amino acids 401 to 430 (30 residues), see Phobius details amino acids 472 to 492 (21 residues), see Phobius details PF00916: Sulfate_transp" amino acids 42 to 406 (365 residues), 279.3 bits, see alignment E=4.3e-87 PF01740: STAS" amino acids 467 to 552 (86 residues), 62.2 bits, see alignment E=3.7e-21

Best Hits

KEGG orthology group: K03321, sulfate permease, SulP family (inferred from 100% identity to rru:Rru_A0164)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RY26 at UniProt or InterPro

Protein Sequence (575 amino acids)

>Rru_A0164 Sulfate transporter/antisigma-factor antagonist (NCBI) (Rhodospirillum rubrum S1H)
MDSPRIAPRPSITRPPEEDSFLALFTPKLVTMLRDGYGLGDLRADALAGLTVAIVALPLS
MAIAIASGATPEQGLFTAIVGGFLISALGGSRFQIGGPAGAFIVLVAATVAEHGFAGMIL
ATFVAGLILVAMGLLRLGTYVKFIPYPVTVGFTAGIGVVIFTTQIKDLLGLSLSGPEPGE
ILPKLMALGSALPSITPAALLISIPTIAFIVLQKRFRPGWPGMLLAVALGSFTAWLFNMP
IETVGSRFGEIPRTLPLPSMPVFSFDLLIAVLPDAAAFALLGAIESLLSAVVADGMTGRR
HRSNCELVAQGIANMASALFGGVCATGTIARTATNVRAGARGPIAGMLHALFLLGFLAVA
APLVSYIPLASLAAVLAIVAWNMIERHAFAVLLRTSRGDTVVLMATFLLTIFRDLTEGIV
AGFLIGTLLFLNRMAKATVVEADQPLIAEDRADGAFGRSAYDAALASDPRVVVYRISGAF
FFGAASTVGSVLDRIADQRKAFVLDFAAVPFLDSTAANAIEGAVRKAQRHKVKVFFTGAS
PKVRRTLLAHDLRPPRVIYKRTIDDAVTAVKAEPI