Protein Info for Rru_A0157 in Rhodospirillum rubrum S1H

Annotation: Drug resistance transporter EmrB/QacA subfamily (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 114 to 138 (25 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 341 to 360 (20 residues), see Phobius details amino acids 371 to 390 (20 residues), see Phobius details amino acids 487 to 510 (24 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 23 to 510 (488 residues), 477.4 bits, see alignment E=2.6e-147 PF07690: MFS_1" amino acids 26 to 420 (395 residues), 160.8 bits, see alignment E=2.2e-51

Best Hits

Swiss-Prot: 45% identical to EMRB_ACIBT: Colistin resistance protein EmrB (emrB) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: K03446, MFS transporter, DHA2 family, multidrug resistance protein B (inferred from 100% identity to rru:Rru_A0157)

Predicted SEED Role

"Multidrug resistance protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RY33 at UniProt or InterPro

Protein Sequence (524 amino acids)

>Rru_A0157 Drug resistance transporter EmrB/QacA subfamily (NCBI) (Rhodospirillum rubrum S1H)
MAAAPASAAVSGGALPLRDRLGFFALVVGMFMAILDIQIVASSLAEIQAGVSAGPEEISW
VQTGYLIAEVVMIPLSGWLSRLMSTRWLFTMASGGFTIASGLCAIAWNLESLVAFRVVQG
FLGGAMIPTVFAAAFALFPGKKQAGVSVVIGLVATCAPALGPTIGGHLTEALSWHWLFLL
NLPVGAAVTVAAATLVHFDEADPSLLRRIDLIGIGLVAVCLGSLQYILEEGPRDDWFDSA
PIVFFTACAAIGGVLLVWRELTAKDPVVDLRAFLDRNFVLGCLYSFITGVGLYGAVYLMP
LFLARVRDLNPAQIGEVVMITGLFQFLSAPLAGALSRKLDLRVMLSFGLLMFALGLWLNT
HLTHDWDYWEFFLPQAVRGVSLMFIFIPINRLSLGTLPKEKLGNASGLYNLMRNLGGAIG
LAAITTMLTDQTKIHYSYLAENVTTARLAAEATLSGMERHFDPVLGSSSAQAALGQVRQI
VMREATVMAFADVFTAVAVVFAFGLLLMPFVHKVGGNGPDGGGH