Protein Info for Rru_A0148 in Rhodospirillum rubrum S1H

Annotation: GTP-binding protein TypA (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 613 TIGR01394: GTP-binding protein TypA/BipA" amino acids 4 to 605 (602 residues), 916.3 bits, see alignment E=6.7e-280 PF00009: GTP_EFTU" amino acids 4 to 199 (196 residues), 189.6 bits, see alignment E=1.3e-59 TIGR00231: small GTP-binding protein domain" amino acids 4 to 152 (149 residues), 80 bits, see alignment E=1.7e-26 PF01926: MMR_HSR1" amino acids 7 to 128 (122 residues), 23.2 bits, see alignment E=1.9e-08 PF22042: EF-G_D2" amino acids 213 to 295 (83 residues), 33.9 bits, see alignment E=8.4e-12 PF03144: GTP_EFTU_D2" amino acids 223 to 294 (72 residues), 39.4 bits, see alignment E=2e-13 PF00679: EFG_C" amino acids 404 to 486 (83 residues), 74.5 bits, see alignment E=1.7e-24 PF21018: BipA_C" amino acids 491 to 599 (109 residues), 159.7 bits, see alignment E=5.8e-51

Best Hits

Swiss-Prot: 53% identical to TYPA_SYNY3: GTP-binding protein TypA/BipA homolog (typA) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K06207, GTP-binding protein (inferred from 100% identity to rru:Rru_A0148)

Predicted SEED Role

"GTP-binding protein TypA/BipA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RY42 at UniProt or InterPro

Protein Sequence (613 amino acids)

>Rru_A0148 GTP-binding protein TypA (NCBI) (Rhodospirillum rubrum S1H)
MTTLRNIAIIAHVDHGKTTLVDALLKQSGSFRENQKVDERALDSNDLERERGITILAKCT
SVDWKGVRVNIVDTPGHADFGGEVERILSMVDGVVLLVDAAEGPLPQTKFVLGKALALGL
RPIVVINKVDRPDARAHEVHDEVFDLFANLGASDKQLDFPCLFASGRNGWAVNTLEEIDG
GTEGLTLEPLFKLVVDHVPAPERVLDAPFAMLATTLEYDPYLGRVLTGRILSGRAKINMP
IKALARDGRILEQGRASKLLAFRGLNRVPVEEAEAGDIIAIAGIAKATVADTLCALELDQ
PIYAAPIDPPTLAMTFSVNDSPLAGLEGDKLTSRVIAARLAREAEGNVAIHIRETEDKDA
FEVAGRGELQLGVLIETMRREGFELSISRPRVLYKTDEQGGNREEPIEEVVIDVDEEFSG
TVVDKMSQRKAELQEMKPSGGGKLRLVFHAPSRGLIGYHGEFLTDTRGTGIMNRLFHGYA
PFKGTIDGRREGVLISNGAGDAVAYAIFNLQDRGPMFIEPGVKVYEGMIVGEHNRGNDLE
INVLKGKQLTNIRASGKDEAIRLTPPLRKSLEEALAYIQDDELVEVTPKTIRLRKRWLDS
NERKKRSKKVSEA