Protein Info for Rru_A0146 in Rhodospirillum rubrum S1H

Annotation: Inorganic diphosphatase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00719: Pyrophosphatase
  • amino acids 18 to 171 (154 residues), 186.7 bits, E=1.2e-59

Best Hits

Swiss-Prot: 100% identical to IPYR_RHORT: Inorganic pyrophosphatase (ppa) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01507, inorganic pyrophosphatase [EC: 3.6.1.1] (inferred from 100% identity to rru:Rru_A0146)

MetaCyc: 55% identical to inorganic diphosphatase (Sinorhizobium meliloti 1021)
Inorganic diphosphatase. [EC: 3.6.1.1]

Predicted SEED Role

"Inorganic pyrophosphatase (EC 3.6.1.1)" in subsystem Phosphate metabolism (EC 3.6.1.1)

MetaCyc Pathways

• glyphosate degradation III (2/7 steps found)
• (aminomethyl)phosphonate degradation (2/8 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.1

Use Curated BLAST to search for 3.6.1.1

Sequence Analysis Tools

See Q9RGQ1 at UniProt or InterPro

Protein Sequence (179 amino acids)

>Rru_A0146 Inorganic diphosphatase (NCBI) (Rhodospirillum rubrum S1H)
MDIKKIPVGKNPPQDVNVIIEIPLLADPVKYEVDKESGAMFVDRFLHTAMHYPCNYGFVP
HTLSDDGDPVDVMVVGRIPVAVGSVMRTRPVGVLYMEDEAGRDEKILGVPHSKLYPYHDN
VNNFGDLRPIELRRIEHFFAHYKDLEEGKWVKILGWGNYKEAWDVIERGIAAEAAHKKV