Protein Info for Rru_A0128 in Rhodospirillum rubrum S1H

Annotation: Na+/H+ antiporter NhaA (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 209 to 238 (30 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details amino acids 293 to 318 (26 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 369 to 389 (21 residues), see Phobius details PF06965: Na_H_antiport_1" amino acids 9 to 389 (381 residues), 491.1 bits, see alignment E=1e-151 TIGR00773: Na+/H+ antiporter NhaA" amino acids 9 to 389 (381 residues), 461.5 bits, see alignment E=1e-142

Best Hits

Swiss-Prot: 100% identical to NHAA_RHORT: Na(+)/H(+) antiporter NhaA (nhaA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03313, Na+:H+ antiporter, NhaA family (inferred from 100% identity to rru:Rru_A0128)

Predicted SEED Role

"Na+/H+ antiporter NhaA type" in subsystem Na(+) H(+) antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RY62 at UniProt or InterPro

Protein Sequence (399 amino acids)

>Rru_A0128 Na+/H+ antiporter NhaA (NCBI) (Rhodospirillum rubrum S1H)
MPLQAIVSFLRLDIAAGVILVGAAVLALIAANSPAAALYEQVFQTPFVIGYGPWLLEKPL
LLWINDGLMAVFFLLVGLEIKREVRGGELSTPRLAALPAVAAVGGMVVPALIYASLTWGD
AFALRGWAIPAATDIAFALGILTLLGPRVPISLKIFLTALAIIDDLGAILIIAFFYTASL
SPLALLLAAACLALLIGLNLSGQRRLWPYLLIGVVLWVCVLKSGVHATLAGVVLALTIPL
GATDDESASADKPLERLEHGLHPWVTYAILPLFAFANAGVSLAGLPPSALLAPVPLGIVL
GLFLGKQIGVFGFSWLAIRSGLAPMPQGARWRDLYGVALITGVGFTMSLFIGTLAFETSD
PLAADFGTEVRLGVLSGSLLSGVIGYLVLRLSRRNPATE