Protein Info for Rru_A0127 in Rhodospirillum rubrum S1H

Annotation: ABC-2 transporter component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 47 to 65 (19 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 123 to 150 (28 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details PF01061: ABC2_membrane" amino acids 49 to 236 (188 residues), 31.3 bits, see alignment E=7.3e-12

Best Hits

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 100% identity to rru:Rru_A0127)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RY63 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Rru_A0127 ABC-2 transporter component (NCBI) (Rhodospirillum rubrum S1H)
MSVSSPLPPPGSPVGAADRAFSGRRVFAIVLRHWYLMRGSLPRLLEMAYWPIIQVVTWGF
ITQFLMGQSSLIAQAAGIFLGAVLLWDVLFRGNLGVSLSFVEEMWSRNLGQLFVSPLRPY
ELAALMVMSILRTLVGVVPASLLAIAFYAFNIYALGLPLLAFFANLLVMGWAIGLIVCAF
LLRFGMGAESMAWVMVFAFWPIAGIYYPIDVMPPVLQAIAYAFPPAHVFEGMRQLMIDGS
FSMGHFWAAVGLNVFYLGGALGLFLWVFRIARRRGLLLDVGE