Protein Info for Rru_A0123 in Rhodospirillum rubrum S1H

Annotation: RfaE-HldE bifunctional protein, D-beta-D-heptose 7-phosphate kinase, D-beta-D-heptose 1-phosphate adenosyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 TIGR02198: bifunctional protein RfaE, domain I" amino acids 12 to 324 (313 residues), 371.7 bits, see alignment E=4.1e-115 PF00294: PfkB" amino acids 19 to 314 (296 residues), 139.4 bits, see alignment E=3.4e-44 PF08543: Phos_pyr_kin" amino acids 200 to 299 (100 residues), 31.9 bits, see alignment E=1.8e-11 TIGR02199: bifunctional protein RfaE, domain II" amino acids 345 to 485 (141 residues), 193 bits, see alignment E=3.3e-61 TIGR00125: cytidyltransferase-like domain" amino acids 356 to 421 (66 residues), 53.7 bits, see alignment E=2.8e-18 PF01467: CTP_transf_like" amino acids 358 to 462 (105 residues), 55.2 bits, see alignment E=1.8e-18

Best Hits

Swiss-Prot: 100% identical to HLDE_RHORT: Bifunctional protein HldE (hldE) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03272, D-beta-D-heptose 7-phosphate kinase / D-beta-D-heptose 1-phosphate adenosyltransferase [EC: 2.7.1.- 2.7.7.-] (inferred from 100% identity to rru:Rru_A0123)

Predicted SEED Role

"ADP-heptose synthase (EC 2.7.-.-) / D-glycero-beta-D-manno-heptose 7-phosphate kinase" in subsystem LOS core oligosaccharide biosynthesis (EC 2.7.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.-.-, 2.7.1.-, 2.7.7.-

Use Curated BLAST to search for 2.7.-.- or 2.7.1.- or 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RY67 at UniProt or InterPro

Protein Sequence (496 amino acids)

>Rru_A0123 RfaE-HldE bifunctional protein, D-beta-D-heptose 7-phosphate kinase, D-beta-D-heptose 1-phosphate adenosyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MDPTPALAEIVASLARVRVLCVGDVMLDRFVRGDVERISPEAPIPIVRVRDERAMLGGAG
NVVRNIVALGGRCAFMAVIGEDRAGAEIGGLLGDEHKVDSFIGIQPNRRTSVKTRFFAGS
QQLLRADDETIAPLDPYDADRLLGDVRSQITTVGALVLSDYGKGVLDGPVAASLIAMGRT
QNLPVIVDPKGRDFTRYRGATVLTPNRKELAEATGLPTGTDDEVVTACRQVIARCGVDTV
LATRSQDGMTLVGADGSVLHLPAEAREVYDVSGAGDTVVATLAAALAGGAPLAVACRLAN
LAAGIVVGRVGTAAVPAADLMAAVHQEEVSARDSKIVGAEDAREVVDKWRRHGLRIGFTN
GCFDLLHPGHVSLLRQARAACDRLVVGLNSDASVRRLKGDSRPVQDETARAIVLASLADV
DLVAVFGEDTPLGLITTLLPDVLVKGADYTVDTVVGSDVVLTNGGRVLLADLKAGFSTTS
TIARLHGGSRRSGDTL