Protein Info for Rru_A0106 in Rhodospirillum rubrum S1H

Annotation: TPR repeat, Tetratricopeptide TPR_4 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13432: TPR_16" amino acids 75 to 138 (64 residues), 33.3 bits, see alignment E=2.3e-11 amino acids 154 to 205 (52 residues), 19 bits, see alignment E=6.9e-07 PF07719: TPR_2" amino acids 104 to 137 (34 residues), 26.8 bits, see alignment 1.7e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0106)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RY84 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Rru_A0106 TPR repeat, Tetratricopeptide TPR_4 (NCBI) (Rhodospirillum rubrum S1H)
MRSFVLSLCLALGAFAPLSLAAEGALSEAIESPTPGAGLEGAEVLGDLAPAEGAFLAEEA
PRVAVAGGSAARLVEEGYRALAEGRTAEALAAYRAATRAAPALAEAHLGLGASLQALGRP
TEAAGAYERALALRPGDALARARLVAVLGDLAPGIALERLGRLAVAYPDDAEITGRIGLQ
LMRQGRPLAALGAFEQAAALAPGDPVRQVNLAVAADRAGQAARALAAYRKAVTLLRAGGE
TAGVDLAALSRRARWLEVRLEGVTP