Protein Info for Rru_A0102 in Rhodospirillum rubrum S1H

Annotation: Putative diguanylate cyclase (GGDEF domain) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 112 to 277 (166 residues), 152 bits, see alignment E=6.2e-49 PF00990: GGDEF" amino acids 116 to 274 (159 residues), 160.2 bits, see alignment E=1.9e-51

Best Hits

KEGG orthology group: K02488, two-component system, cell cycle response regulator (inferred from 100% identity to rru:Rru_A0102)

Predicted SEED Role

"diguanylate cyclase (GGDEF domain) with PAS/PAC sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RY88 at UniProt or InterPro

Protein Sequence (278 amino acids)

>Rru_A0102 Putative diguanylate cyclase (GGDEF domain) (NCBI) (Rhodospirillum rubrum S1H)
MGDIEGINIQSMASEIKKLRHKIETLEQQNSDLEIALTTAVEHGDAIESELFSTNDRLRG
EVRERVIAERRLSKVLTVVSQQKDDLEVLVQTITEHSDEIDTQWLSRYSEVEALARLDPL
TSIANRRMLDSALEQEWTRSLRSGSPLSVAMCDLDLFKAYNDRYGHNRGDQVLIAFAEIL
RGCSRRPPDLPARVGGEEFLILFPETDLAGARQVAEAIRLALWTLAIPHADSPHGRVTVS
IGLACVFPRPEGDPADLIAQADFRLYEAKAHNRNTVRA