Protein Info for Rru_A0098 in Rhodospirillum rubrum S1H

Annotation: Cystathionine gamma-synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 84 to 100 (17 residues), see Phobius details amino acids 240 to 257 (18 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details PF01053: Cys_Met_Meta_PP" amino acids 12 to 401 (390 residues), 370.3 bits, see alignment E=1.7e-114 PF01041: DegT_DnrJ_EryC1" amino acids 67 to 193 (127 residues), 22.8 bits, see alignment E=1e-08 PF00155: Aminotran_1_2" amino acids 69 to 190 (122 residues), 30.7 bits, see alignment E=3.8e-11 PF00266: Aminotran_5" amino acids 94 to 236 (143 residues), 27.3 bits, see alignment E=3.6e-10

Best Hits

KEGG orthology group: K01739, cystathionine gamma-synthase [EC: 2.5.1.48] (inferred from 100% identity to rru:Rru_A0098)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.48

Use Curated BLAST to search for 2.5.1.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RY92 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Rru_A0098 Cystathionine gamma-synthase (NCBI) (Rhodospirillum rubrum S1H)
MKPGPFPPLAQATLALHAGTTDESDGAQVLNPLVPATSFFTKPEAVGFSANDMAEDTPFL
YTRWNNPTNALLEERLAALEGGEAAVVFASGMAALSGLFLSQLKAGDHLVISSVCYAGLA
EVAHDILPGLGIATTAVDTSNLEAVRAALRPETRLIHIETPGNPILRLSDIEALAAIAHA
HGALLSVDSTMATPIATRPLALGADFVAHSLTKYACGHGDALGGAIIGKAQAMAALRKHA
LIHFGGAISPFAAWLILRGLETLSLRMAGHQAGAAAVAAYLEGHPRLRRVLWPGLPSHPQ
HALACRQMKNFSGMVSFSADDGPALARQLAERLQVISYAVSLGKTRSLLFYIPTEALIAS
SFHLDGDDARSYRDWTGDGTFRLSVGLEDPADLIADLERALAP