Protein Info for Rru_A0094 in Rhodospirillum rubrum S1H

Annotation: Binding-protein-dependent transport systems inner membrane component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 213 to 238 (26 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 121 to 296 (176 residues), 48.8 bits, see alignment E=3.5e-17

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to rru:Rru_A0094)

Predicted SEED Role

"ABC-type sugar transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RY96 at UniProt or InterPro

Protein Sequence (312 amino acids)

>Rru_A0094 Binding-protein-dependent transport systems inner membrane component (NCBI) (Rhodospirillum rubrum S1H)
MRDGSIRDAGPPLPAPPPPRAAPIAGQSAGGRLALRIGLYAVLVLFALYYLLPLFVMLLT
SVKTLDDIRAGSLIALPRTLTFEPWLKAWDSACVGVQCAGLKPYFLNSLLLVVPAVAIST
VLGALNGYALTKWRFPGSQLIFALMLFGCFIPFQVVLLPMARVLGLAGLAGSIQGLILVH
VVYGLSFTTLFFRNFYMTVPDELVRAATIDGAGFFRIFFSILLPMSPPIIVVTIIWQFTQ
IYNDFLFGVSFTVSGGQPVTVALNNLVASSTGVKEYNVDMAAAILTALPTLVVYAVAGKY
FIRGLSAGAVKG