Protein Info for Rru_A0093 in Rhodospirillum rubrum S1H

Annotation: Binding-protein-dependent transport systems inner membrane component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 198 to 222 (25 residues), see Phobius details amino acids 258 to 281 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 82 to 282 (201 residues), 49.7 bits, see alignment E=1.9e-17

Best Hits

Swiss-Prot: 31% identical to YURN_BACSU: Probable ABC transporter permease protein YurN (yurN) from Bacillus subtilis (strain 168)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to rru:Rru_A0093)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RY97 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Rru_A0093 Binding-protein-dependent transport systems inner membrane component (NCBI) (Rhodospirillum rubrum S1H)
MRDLDRLIPKLVIAPSFAAALLFVYGFIGWTVYISFTKSGILPRYELDGVGQYARLFANP
RWDVAVSNLFVFGGLFIALCLVIGILLAILIDQKIRAEGVLRTIYLYPMAVSFIVTGTAW
KWILNPGLGLDKVMHGLGWEGFSFDWLINPERAIYTVVIAGVWQSSGFVMALFLAGLRSF
DQEVIKAATIDGAGMPTVYFRIILPSLHAVFLSAVVVLAHLAVKSFDLVVALTGGGPGYA
TDMPATFMYAMAFQRSQLGTAAASAVMMLMTVMAIIVPYLYSELRERRS