Protein Info for Rru_A0089 in Rhodospirillum rubrum S1H

Annotation: ATP-dependent DNA helicase RecQ (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 33 to 627 (595 residues), 733.3 bits, see alignment E=2e-224 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 35 to 481 (447 residues), 465.1 bits, see alignment E=2.6e-143 PF00270: DEAD" amino acids 45 to 206 (162 residues), 87.9 bits, see alignment E=1.6e-28 PF00271: Helicase_C" amino acids 247 to 349 (103 residues), 59.1 bits, see alignment E=1.2e-19 PF16124: RecQ_Zn_bind" amino acids 361 to 421 (61 residues), 64.3 bits, see alignment 3.6e-21 PF09382: RQC" amino acids 426 to 533 (108 residues), 106.8 bits, see alignment E=1.5e-34 PF00570: HRDC" amino acids 560 to 626 (67 residues), 81.3 bits, see alignment E=1e-26

Best Hits

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 100% identity to rru:Rru_A0089)

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RYA1 at UniProt or InterPro

Protein Sequence (629 amino acids)

>Rru_A0089 ATP-dependent DNA helicase RecQ (NCBI) (Rhodospirillum rubrum S1H)
MVPDVSPLPSPGSPLPSPGSPCADAVSADPARVLLADIWGFKDFRPGQEAIIRAVLGGED
VLAVMPTGSGKSLCYQLPALMRQGVTLVVSPLIALMRDQVAQLDALGVAAGALNSSIDMD
GYRRVMDGLRGGRLKLLYVAPERLARPDTLSLLRDSGVTALAIDEAHCVSQWGHDFRPDY
LCLGKVREDLGGVQTVAFTATADAATRDDIAGRLFPAPPRLFIGGFDRPNLRLAMRPKGD
TRRRMFEFVAAHTGESGVIYCGSRARTEELAEGLRGAGHRALPYHAGLDKPVRDANQDAF
LAEDGLVMVATVAFGMGIDKPDVRFVCHADMPRSIEAYYQEIGRAGRDGLAADTLTFYGL
DDVRLHRMRIEESQAGDEQKRVEIQRLNALLALCEAPRCRRQTLLGYFGERTEPCGNCDL
CINGVESFDGTIEAQKAMSAMLRTGQRFATEHLINILVGTQTDAITQYGHDKLPTFGVGK
DHTRNVWRSIFRQISAGGLISLDIANHGRWLMTEAGRAVLRGQAGVALRSDVLEAAGRGE
RKDKERRASAPAVQLEADDRALFDALRAKRQELARAENVPAYVVFADRTLIELATKRPPS
LDAMREIHGIGQSKLARYGAAFLEVITAG