Protein Info for Rru_A0084 in Rhodospirillum rubrum S1H

Annotation: Peptidase S33, proline iminopeptidase 1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 TIGR01249: prolyl aminopeptidase" amino acids 15 to 312 (298 residues), 363.4 bits, see alignment E=4.5e-113 PF00561: Abhydrolase_1" amino acids 42 to 299 (258 residues), 95.3 bits, see alignment E=9.5e-31 PF12697: Abhydrolase_6" amino acids 43 to 299 (257 residues), 38.8 bits, see alignment E=3.4e-13 PF12146: Hydrolase_4" amino acids 58 to 146 (89 residues), 32.6 bits, see alignment E=1.1e-11 PF08386: Abhydrolase_4" amino acids 256 to 312 (57 residues), 23 bits, see alignment E=1.4e-08

Best Hits

Swiss-Prot: 48% identical to PIP_NEIGO: Proline iminopeptidase (pip) from Neisseria gonorrhoeae

KEGG orthology group: K01259, proline iminopeptidase [EC: 3.4.11.5] (inferred from 100% identity to rru:Rru_A0084)

Predicted SEED Role

"Proline iminopeptidase (EC 3.4.11.5)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 3.4.11.5)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.5

Use Curated BLAST to search for 3.4.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RYA6 at UniProt or InterPro

Protein Sequence (318 amino acids)

>Rru_A0084 Peptidase S33, proline iminopeptidase 1 (NCBI) (Rhodospirillum rubrum S1H)
MNSPDPLADLYPPIEPRHTGRLRVRPPHVIHWEESGNPDGIAVIFVHGGPGAGTAPFCRR
YFDPERYRVIIFDQRGAGRSRPFAEIADNTTQELVADMERLRVHLEVERWLVFGGSWGST
LALAYGQTHPERCLGFILRGVFLFRGFEVDWFLNGMGRFFPEAASAFLDFLPEDERADPL
AAYYRRLTHADPSIHLAAARVWSNYEDACARLRPRPGDEGDGRSALALARLECHYMRHGG
FLREGQLLTEIDRVRDLPCTIVQGRYDVVCPPVSAWELHRVWTGSKLVMVPDAGHSALEP
GVRVALVQATRRFAESQG