Protein Info for Rru_A0072 in Rhodospirillum rubrum S1H

Annotation: chaperone protein Hsp90 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 626 PF13589: HATPase_c_3" amino acids 32 to 153 (122 residues), 33.7 bits, see alignment E=3.6e-12 PF00183: HSP90" amino acids 215 to 625 (411 residues), 371.3 bits, see alignment E=1e-114

Best Hits

Swiss-Prot: 100% identical to HTPG_RHORT: Chaperone protein HtpG (htpG) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K04079, molecular chaperone HtpG (inferred from 100% identity to rru:Rru_A0072)

Predicted SEED Role

"Chaperone protein HtpG" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RYB8 at UniProt or InterPro

Protein Sequence (626 amino acids)

>Rru_A0072 chaperone protein Hsp90 (NCBI) (Rhodospirillum rubrum S1H)
MSEETLSFQAEVSKLLDIVVHSLYSDRKIFLRELISNASDACDKLRYEGLTQPALLEGDG
AFRIRLSIDAEAGTLTIADNGIGMNRHELIENLGTIARSGTQAFAEALKAKSQAASGDVS
LIGQFGVGFYSAFMVADKVEVVTRRAGEAQGWRWSSDGKGSFSVSEVEGAGRGAAITLHL
REDARDFLDEHRLREIVKTYSDHIAIPVDYAGKEGEPERLNEASALWTRPRDQITDEQYA
EFYHHVAHGFETPWHTLHYRAEGKLEYTALLFVPGQQPFDLFTQDRKPRVKLYVNRVFIT
DDCEELLPSYLRFVRGVVDSSDLPLNVSREMLQDDPRLRKIKGGLTKRLIDDLAKRARDD
ESAYLTFWENFGAVLKEGIYEDFERKEDLVALARFRTTASDTPVSLETVIGRMKEGQSAL
YYITGDDATALARSPQVEGFVARGVEVLLLTDPIDEFWVSAVPKVGDTALKAVAQGSADL
ERLALIDGKQPPDDAEHAPAETAKMDALIAAMKAALGTAVADVRVSARLTDSPVCLVAKE
GAMSLHLQKLLRQANQGSELSGDRVLEINPRHALVKTLAERAATGGSVDEAALLLMDQAR
ILEGEAPADAIAFARRLTEVMGKGLI