Protein Info for Rru_A0060 in Rhodospirillum rubrum S1H

Annotation: Radical SAM (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 TIGR03470: hopanoid biosynthesis associated radical SAM protein HpnH" amino acids 1 to 318 (318 residues), 539.5 bits, see alignment E=1.2e-166 PF04055: Radical_SAM" amino acids 35 to 186 (152 residues), 75.3 bits, see alignment E=6.6e-25 PF11946: DUF3463" amino acids 196 to 328 (133 residues), 202.1 bits, see alignment E=3e-64

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0060)

MetaCyc: 61% identical to adenosyl hopane synthase (Rhodopseudomonas palustris TIE-1)
RXN-13528

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RYD0 at UniProt or InterPro

Protein Sequence (387 amino acids)

>Rru_A0060 Radical SAM (NCBI) (Rhodospirillum rubrum S1H)
MGVPLIQQIRIGAYLMRQRISGNQRYPLVLMLEPLFRCNLACAGCGKIDYPDSILNRRLS
LEDCLGASDECGAPIVSIAGGEPLLHRDIVPIVEGLTARKRFVYLCTNALLLKKRMDDFK
PSPYLTFSIHLDGDREHHDKAVSQEGVFDKAVEAIKLAREKGFRVTCNTTLFEGVPPERI
AKFISYASNELGVEGVTVAAGFAYERAPLKDVFLGRQKTKQLFRDLFKLRDKSWRFNQSS
LYLDFLAGNQTYHCTPWGNPTRNVFGWQRPCYLLNEGTVGSFRELMETTDWDSYGTGRYE
KCANCMMHCGYEPTAVADTVAHPLKALAVALRGVRTEGPMAPEISFEGQRPAEYVFESVV
KAELEKAPPATAKKAKAAAEAQSSAAE