Protein Info for Rru_A0058 in Rhodospirillum rubrum S1H

Annotation: Dihydrokaempferol 4-reductase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR03466: hopanoid-associated sugar epimerase" amino acids 1 to 329 (329 residues), 510.1 bits, see alignment E=1e-157 PF04321: RmlD_sub_bind" amino acids 1 to 155 (155 residues), 35.8 bits, see alignment E=2e-12 PF05368: NmrA" amino acids 2 to 114 (113 residues), 62.1 bits, see alignment E=2.8e-20 PF02719: Polysacc_synt_2" amino acids 3 to 119 (117 residues), 30.7 bits, see alignment E=7.9e-11 PF01370: Epimerase" amino acids 3 to 230 (228 residues), 134.1 bits, see alignment E=2.2e-42 PF16363: GDP_Man_Dehyd" amino acids 4 to 240 (237 residues), 59.8 bits, see alignment E=1.4e-19 PF01073: 3Beta_HSD" amino acids 4 to 154 (151 residues), 77.8 bits, see alignment E=2.9e-25 PF13460: NAD_binding_10" amino acids 7 to 170 (164 residues), 75.3 bits, see alignment E=2.3e-24 PF07993: NAD_binding_4" amino acids 57 to 178 (122 residues), 51.6 bits, see alignment E=3.1e-17

Best Hits

Swiss-Prot: 47% identical to DFRA_SYNY3: Putative dihydroflavonol 4-reductase (dfrA) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00091, dihydroflavonol-4-reductase [EC: 1.1.1.219] (inferred from 100% identity to rru:Rru_A0058)

Predicted SEED Role

"Dihydroflavonol-4-reductase (EC 1.1.1.219)" in subsystem Biflavanoid biosynthesis or Tannin biosynthesis (EC 1.1.1.219)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.219

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RYD2 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Rru_A0058 Dihydrokaempferol 4-reductase (NCBI) (Rhodospirillum rubrum S1H)
MTVLVTGASGFVGAAVVRALLARGQNVRALVRDTSPRRNLEGLPLETVIGDLTDTASLRA
AARGVDALYHVAADYRLWTLDPPAMFRANVEGSVAVIRAAAEAGAKRIVYTSSVAVIKPK
ADGTPADETTPTLASDMIGPYKLSKFEAERAVQRLITNEGAPVVIVNPSTPIGPRDIKPT
PTGRMIVEAALGKMPAYVDTGLNVAHVEDVAEGHLLAFDRGEIGERYILGGEDMSLRDIL
FTIARLTGGKPPRVSLPHGLIVPLAWAVETLARLRRSETEPFVTLDGLRMARKHMFFSSA
KARTALGYAPRPAEQALADALVWFRANGFLDPR