Protein Info for Rru_A0057 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 889 transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 321 to 344 (24 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 398 to 417 (20 residues), see Phobius details amino acids 424 to 448 (25 residues), see Phobius details amino acids 477 to 495 (19 residues), see Phobius details amino acids 731 to 752 (22 residues), see Phobius details amino acids 759 to 781 (23 residues), see Phobius details amino acids 787 to 808 (22 residues), see Phobius details amino acids 828 to 847 (20 residues), see Phobius details amino acids 854 to 880 (27 residues), see Phobius details TIGR03480: hopanoid biosynthesis associated RND transporter like protein HpnN" amino acids 23 to 883 (861 residues), 1096.3 bits, see alignment E=0 PF03176: MMPL" amino acids 253 to 452 (200 residues), 65.5 bits, see alignment E=2.1e-22 amino acids 712 to 883 (172 residues), 41.7 bits, see alignment E=3.8e-15

Best Hits

KEGG orthology group: K07003, (no description) (inferred from 100% identity to rru:Rru_A0057)

Predicted SEED Role

"Hopanoid-associated RND transporter, HpnN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RYD3 at UniProt or InterPro

Protein Sequence (889 amino acids)

>Rru_A0057 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MTASQPPAQVPPPARNDIITRATVAWVGFAHRRPWTVLAITVLLMALSGWAAATRLGMST
DTSAMLSPDLPFQRDQARFSQAFPDLGGGLVVVIDGQTPELADRGAHALVEGLALRRDVI
LDSVDIAGLPFFRQNGLLYLPLDQLDKLSTTLVRAQPFIAGLWADPSLRGLAAMMDLALG
QGADALSKQKPGEGFALAPILDAMAEVTAATARGTSAHMAWSSVLGAPAVTGTPGRRFVL
VKPVLDHSSLAPAAGAMNAIRAVAESRDLRAAAGITLRITGPAALDQEELASVSTGMDRA
GLVTTVLVAIILAVGLGSGRLIFATLMTMGAGLLMTIGFAAAAVGTLNLISVAFAVLFIG
LSVDFGIHFGLRYREGRDRGLENGLALEGAARGAGRSQFLVALAAAFAFFAFLPTDYLGL
AQLGLISGVGMFIALLINQSTLASLMTLMPAKPRGNWRSESRPTSGLAQVPRRHPRVVLG
LFVVLAIGALALLPRARFDFDPLNLKDPRTESVATLLDIMGDPGLDPYSINVLAANASQA
AVLTEALKALPEVRGVASLPALVPADQDAKLAVIDDLAFVLGPSLSVDPRDPPSAPDLAA
ARDHLARRLAQTSQGSGPLATAAGRLAAALSSLPNDTALLRALDDRLLDGLAHQLALFRD
GLNAQPVSADDIPPELRRRYMAADGRARLEVFPRATARDYATLARFVEAVRTVAPDATGA
PVLIIEAGRTVMGAFVEAAAISAVLIAIMLAISLRSGRAVVLIFAPVILAGTLTIGASVL
AGQAFNFANVIVLPLLVGLGVSGGIYVVERTREERDSGTALASSTPRAVMFSAFTTIASF
GSIALSSHPGTASMGILLTIALGLSLLCTLAFLPALVALWPERRRQPSL