Protein Info for Rru_A0049 in Rhodospirillum rubrum S1H

Annotation: Biotin/lipoyl attachment (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 PF00364: Biotin_lipoyl" amino acids 68 to 133 (66 residues), 60.8 bits, see alignment E=8.9e-21 PF13533: Biotin_lipoyl_2" amino acids 70 to 100 (31 residues), 24.7 bits, see alignment 1.6e-09

Best Hits

Swiss-Prot: 39% identical to GCDC_ACIFV: Glutaconyl-CoA decarboxylase subunit gamma (gcdC) from Acidaminococcus fermentans (strain ATCC 25085 / DSM 20731 / VR4)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0049)

MetaCyc: 42% identical to (S)-methylmalonyl-CoA decarboxylase gamma subunit (Veillonella parvula)
RXN-19738 [EC: 7.2.4.3]

Predicted SEED Role

"Biotin carboxyl carrier protein of acetyl-CoA carboxylase; Biotin carboxyl carrier protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.4.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RYE1 at UniProt or InterPro

Protein Sequence (134 amino acids)

>Rru_A0049 Biotin/lipoyl attachment (NCBI) (Rhodospirillum rubrum S1H)
MMKRLRITVEGTAYDVTVEELDAPEGATAPLAAAPSASARPPAPATPRPAAPPPAPAAPA
LPVGEGAVVSPLAGTVVKLAVANGQSVAIGDVLVVLEAMKMNTPIAATRAGQVTAIAVAV
GTTVSEGQVLLTLG