Protein Info for Rru_A0039 in Rhodospirillum rubrum S1H

Annotation: Cytochrome c-type biogenesis protein CcmB (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 92 to 121 (30 residues), see Phobius details amino acids 128 to 154 (27 residues), see Phobius details amino acids 161 to 187 (27 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details PF03379: CcmB" amino acids 5 to 218 (214 residues), 255.7 bits, see alignment E=1.6e-80 TIGR01190: heme exporter protein CcmB" amino acids 8 to 218 (211 residues), 255.2 bits, see alignment E=2.4e-80

Best Hits

Swiss-Prot: 53% identical to CCMB_PARDP: Heme exporter protein B (ccmB) from Paracoccus denitrificans (strain Pd 1222)

KEGG orthology group: K02194, heme exporter protein B (inferred from 100% identity to rru:Rru_A0039)

MetaCyc: 47% identical to cytochrome c maturation protein B (Escherichia coli K-12 substr. MG1655)
RXN-21408

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, CcmB subunit" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RYF1 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Rru_A0039 Cytochrome c-type biogenesis protein CcmB (NCBI) (Rhodospirillum rubrum S1H)
MSGVFLSVLTRELRLALRQGGDSLMVVAFFVVTVVLFPFGVGPEPAVLERISAGVLWVTA
LLASMLSLDRLFQQDYEDGSLDLLVRSSAPLSAVVIAKVAAHWLTSALPLIAAAPLLAVL
LQMRGDGFAVLMAAMALGTPSLSLIGAVGAALVLGARRGGVLVSLLILPLSVPILIFGVS
AVDAAVMGLSYAAQLKVLAAILLVTLALCPFATALALRQAVE