Protein Info for Rru_A0033 in Rhodospirillum rubrum S1H

Annotation: Cytochrome C biogenesis protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 106 to 127 (22 residues), see Phobius details PF03918: CcmH" amino acids 11 to 154 (144 residues), 169.1 bits, see alignment E=1.9e-54

Best Hits

Swiss-Prot: 46% identical to CCMH_BRADU: Cytochrome c-type biogenesis protein CcmH (ccmH) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02200, cytochrome c-type biogenesis protein CcmH (inferred from 100% identity to rru:Rru_A0033)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmL" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RYF7 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Rru_A0033 Cytochrome C biogenesis protein (NCBI) (Rhodospirillum rubrum S1H)
MIRRLFAIAALAWLLAPGAALAVLPDEQLADPALEGRARTLSQGLRCVVCQSENIDESNA
ELARDMRIRLRELLVAGKSDDEAVGYMVERYGDYVLMKPPFKATTLALWLGPFALLLVGA
LGIGLYYRRRGPIGAESAPAALSAAERQRLDHLLADDEPPTPPGDREAGR