Protein Info for Rru_A0032 in Rhodospirillum rubrum S1H

Annotation: TPR repeat (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 102 to 121 (20 residues), see Phobius details TIGR03142: cytochrome c-type biogenesis protein CcmI" amino acids 2 to 124 (123 residues), 121.7 bits, see alignment E=1e-39 PF23914: TPR_CcmH_CycH" amino acids 151 to 273 (123 residues), 48.2 bits, see alignment E=3.3e-16 amino acids 345 to 478 (134 residues), 64 bits, see alignment E=4.5e-21 PF13432: TPR_16" amino acids 153 to 200 (48 residues), 28.3 bits, see alignment 5.7e-10 amino acids 369 to 410 (42 residues), 23.7 bits, see alignment 1.7e-08 PF14559: TPR_19" amino acids 153 to 209 (57 residues), 27.9 bits, see alignment 7.1e-10

Best Hits

KEGG orthology group: K02200, cytochrome c-type biogenesis protein CcmH (inferred from 100% identity to rru:Rru_A0032)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmH" in subsystem Biogenesis of c-type cytochromes or Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RYF8 at UniProt or InterPro

Protein Sequence (494 amino acids)

>Rru_A0032 TPR repeat (NCBI) (Rhodospirillum rubrum S1H)
MMFWILAIALAVATCLLLARPLLRRDGAPPPRARGEYDLAVYRDQLGELERDVDRGLLGA
DQAEAARVEVERRMLAAAPPPPAASDTPQAPPPSAGGDGRKAVLSLIALVPLAALALYLV
VGSPGRPDVPHNERLAQLHEEQRDQTAQSADQIARLRAALASDPDNLEAKLLLGSALAQS
GALAEAAPLLAEAARAAPDSLAVQSAYAQFLVMARNGQIADDAHGVLVHILGIDPGDARA
RFFLGLERLQMEDPQGALAIWRDLQADSPADAPWMAMIAENIAQVATEAGIEPQSIPPRH
PLALLNDDKQATEGRTGAPPKPAPAKPNPAAAATAGTVPAAERERIEVMVDGLASRLADQ
PDDADGWMMLGRSRIVLGQPDAAAEAYGRAVALRPDDLDAKRLQARALLAGAQTKAPSPA
KPAPPPPAVFTLMADILAGAPEDREALFFVGLEAAEKGDSERARSLWTRLIAALDPQSDL
ALELRKRLDALPPA