Protein Info for Rru_B0040 in Rhodospirillum rubrum S1H

Annotation: Type I secretion membrane fusion protein, HlyD (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 transmembrane" amino acids 74 to 93 (20 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 70 to 491 (422 residues), 424.1 bits, see alignment E=3.3e-131 PF25994: HH_AprE" amino acids 148 to 338 (191 residues), 193.6 bits, see alignment E=7.7e-61 PF26002: Beta-barrel_AprE" amino acids 380 to 469 (90 residues), 110.4 bits, see alignment E=7.3e-36

Best Hits

Swiss-Prot: 40% identical to PRSE_RHIME: Type I secretion system membrane fusion protein PrsE (prsE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02022, (no description) (inferred from 100% identity to rru:Rru_B0040)

Predicted SEED Role

"HLYD FAMILY SECRETION PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RMK9 at UniProt or InterPro

Protein Sequence (492 amino acids)

>Rru_B0040 Type I secretion membrane fusion protein, HlyD (NCBI) (Rhodospirillum rubrum S1H)
MTSSSLTPQAIVPPPEARPPAEPPAPPAPSTTAPAQTPAKASAKMPGDTTPARWTEGMLS
IPKVVTDSRQTIRAGWLIILVAFGGLGLWAATAPLSSAVGAPGTIVVESNRKTVQHLEGG
IIKEILVKEGDRVHQGDPLIRLETTQALASAAVVSNQFETYQALEARLVAERDEQKTITF
PPDLIAVAKLKPETAEILQAQQQQFDERHKSIEGQVAILQKRIAQSRQEIEGLKVQRQSK
KRQLEIFQDEIVGLRELLAKGYTPRTRILAMEREMTRLEGEVGTDTSSMARAEQAVGEAE
LQIIQTRQQFREDVVGQLREVQTKLSELRERGTVATDVLSRTVLLASQAGVIQNLAVHTL
GGIIKPGETLMEIVPEDDRLVIEAQISPRDIDNVVPGMDTEVRFSAFNSRTIPIIDGVLS
QVSADRFVNERDSSSYYKARIEVSDEELAKLGGLALRAGMPVDVMIKTGERTVLHYFLKP
LEDALFHGLIEE