Protein Info for Rru_B0028 in Rhodospirillum rubrum S1H

Annotation: ABC transporter related (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 PF00005: ABC_tran" amino acids 48 to 180 (133 residues), 85.5 bits, see alignment E=5.4e-28 PF14524: Wzt_C" amino acids 308 to 444 (137 residues), 137.7 bits, see alignment E=2.8e-44

Best Hits

KEGG orthology group: K09691, lipopolysaccharide transport system ATP-binding protein (inferred from 100% identity to rru:Rru_B0028)

Predicted SEED Role

"Teichoic acid export ATP-binding protein TagH (EC 3.6.3.40)" in subsystem Rhamnose containing glycans or Teichoic and lipoteichoic acids biosynthesis (EC 3.6.3.40)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RMM1 at UniProt or InterPro

Protein Sequence (472 amino acids)

>Rru_B0028 ABC transporter related (NCBI) (Rhodospirillum rubrum S1H)
MSSDPTSGAAITVEGLKKVFRIYERPRDRILQLILPGKRKFYREFQALDDVSFTVQKGQA
VGIIGRNGSGKSTLLQMICGILHPTAGKVSCSGRVAALLELGAGFNPDFTGRENVYMNAT
LLGLTTAAVDERMDDILAFAEIGDFIDHPVKTYSSGMFVRLAFAVMAHVDAEILIIDEAL
AVGDAAFGQKCMRFLRRFRETGTILFVSHDTAAVIGLCDRAVWLDRGKMIIEGDAKTVCE
AYYGHLFGGTVETPPEKTVEAITPSPAPEGPRPKVRAEDWVDGRREWINHSSLRNDIEVF
TFDPSGTDFGAGGAEIEDVRLTDDDGHPYAWIVGGEPTRLRVTVRVRDELRSPIIGFFVK
DRLGQTLFGDNTFMNEKKLSKPALPGQILEANFRFPMPILPPGTYSIAVAVADGTQTDHV
QHHWLHDAVMVKSHVSHATAGLVGIPMFEVRFECHDPVASPSSSMDKVGIVD