Protein Info for Xcc-8004.957.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00221: N-acetylglucosamine-6-phosphate deacetylase
  • amino acids 10 to 383 (374 residues), 323.2 bits, E=1.1e-100
• PF01979: Amidohydro_1
  • amino acids 59 to 383 (325 residues), 96.6 bits, E=1.8e-31
• PF07969: Amidohydro_3
  • amino acids 333 to 375 (43 residues), 33 bits, 5.1e-12

Best Hits

Swiss-Prot: 45% identical to NAGA_VIBCH: N-acetylglucosamine-6-phosphate deacetylase (nagA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01443, N-acetylglucosamine-6-phosphate deacetylase [EC: 3.5.1.25] (inferred from 100% identity to xcb:XC_0754)

MetaCyc: 45% identical to N-acetylglucosamine-6-phosphate deacetylase subunit (Vibrio cholerae non-O1)
N-acetylglucosamine-6-phosphate deacetylase. [EC: 3.5.1.25]

Predicted SEED Role

"N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.1.25)

MetaCyc Pathways

• N-acetylglucosamine degradation II (3/3 steps found)
• N-acetylglucosamine degradation I (2/2 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (2/4 steps found)
• peptidoglycan recycling I (9/14 steps found)
• N-acetyl-D-galactosamine degradation (2/5 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (2/6 steps found)
• chitin derivatives degradation (3/8 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.25

Sequence Analysis Tools

See A0A0H2X5V3 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Xcc-8004.957.1 N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25) (Xanthomonas campestris pv. campestris strain 8004)
LNMDASPIQALCNARVLTDDGLQDGLAVLLDGAQIQAVVAADDARVAQAGTRVDLGGATL
LPGFIDIQVNGGGGVLFNNACTPQALATIAAAHRRYGTTGMLPTLISDTAEVMAEAIAAT
RQAIAQGVPGVLGIHLEGPYLSPARKGTHDAQKFRVPDAHEIAVDTSLDNGVTLITLAPE
RVPLDDIRAFVAGGAVVFAGHTAATYEQARDGIAAGVSGFTHLYNAMSPLAGREPNAVGA
ALEDPAVWCGVIVDGVHVHPASLRVALAAKPRGKLLLVTDAMPMVGADSPSFDLYGETIT
AIDGVVRNAAGALAGSALDMATAVRNSVQWLGVDLAEAARMASTYPAQCIGLGERLGRIA
PGYQADLVLVDADVHVLDTWVAGQRD