Protein Info for Xcc-8004.930.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 603 transmembrane" amino acids 13 to 33 (21 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details PF05227: CHASE3" amino acids 43 to 174 (132 residues), 75.8 bits, see alignment E=8.4e-25 TIGR00229: PAS domain S-box protein" amino acids 229 to 347 (119 residues), 27.2 bits, see alignment E=1.8e-10 PF00512: HisKA" amino acids 370 to 434 (65 residues), 42.2 bits, see alignment E=1.7e-14 PF02518: HATPase_c" amino acids 482 to 592 (111 residues), 77.1 bits, see alignment E=3.7e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcb:XC_0728)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-)" in subsystem Oxidative stress or Oxygen and light sensor PpaA-PpsR (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X450 at UniProt or InterPro

Protein Sequence (603 amino acids)

>Xcc-8004.930.1 Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-) (Xanthomonas campestris pv. campestris strain 8004)
MQTPVREDVWDRWRLPLLAVAVFLIVVVPSLLLQQMAANANQAAEWVSHSQDVQETAQRL
EASMRDTESAAMMRSHGVDRPVLVERMRQGRTEAMKAITHLIALTKDNPGQQVRMGRIQS
TIERRLLLAERIAVTRAPEQIRALIEEMTVSNPIRELIGDLQTAEGRLLSVRNARAERER
LHYKVLSWATLAVQLLLLGTVIWLLQRQIRRRLAAEQEYLRASGRAGSVLQTVREPIVLL
DARQRIVLHNPAFAELYGLEERGNELMLLDDVGDGAWRDPQIHQRLADVLLRDRELWDFE
HEQRGADGVLRTMLINARRMPLPDDGEEEVVLMTVSDISLQKVSQQRIQELNRQLEGKVE
QVSEVNRELEAFSYSVSHDLRAPLRHVAGFSDKLARHLGDAADEKSRHYMEVISSSARRM
ASLIDDLLVYSRLGRSALRLQAVDMQSLVAETRAILDANVQSENTGHRVDWHIAPLPVLI
ADENMMRQLWMNLMGNAVKYSTKREVAKIEIGYEPMPDGGHYFTVRDNGAGFDMDYSGKL
FGVFQRLHKVSEYPGTGIGLASVRRVLARHGGRVWAEGVVDEGATFHFVLPPALEAPNQE
STV