Protein Info for Xcc-8004.862.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Hydrolase, haloacid dehalogenase-like family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 18 to 180 (163 residues), 31.5 bits, see alignment E=1.8e-11 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 20 to 174 (155 residues), 33.3 bits, see alignment E=6e-12 PF00702: Hydrolase" amino acids 20 to 174 (155 residues), 76.1 bits, see alignment E=1e-24 PF12710: HAD" amino acids 20 to 171 (152 residues), 40.3 bits, see alignment E=9.8e-14 PF13419: HAD_2" amino acids 63 to 180 (118 residues), 49.8 bits, see alignment E=9e-17 PF13242: Hydrolase_like" amino acids 136 to 182 (47 residues), 28.9 bits, see alignment 1.8e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcb:XC_0678)

Predicted SEED Role

"Hydrolase, haloacid dehalogenase-like family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X3M3 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Xcc-8004.862.1 Hydrolase, haloacid dehalogenase-like family (Xanthomonas campestris pv. campestris strain 8004)
MDGTVPAGAAPALRSCRHWVFDMDGTLTEAVHDFALIRKELQIPPEADILHHLAALPAAQ
SQAKHAWLLEHERALAEGARAAPGAVALVRALQASGCRLGLLTRNARTLAQVTLQALGLG
DAFAWDDIVGRDEAAPKPAPDGLQYFARRWAVEGSALVMVGDHCNDLACGRAVGACTVLV
NTPGDPWPGLADWRLRDCAQLLAQWQG